{"product_id":"proteintech-26403-1-ap","title":"Proteintech, 26403-1-AP, SLC7A7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC7A7 (26403-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A7 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26403-1-AP targets SLC7A7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse kidney tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23872 Product name: Recombinant human SLC7A7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 459-511 aa of BC010107 Sequence: LIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN Predict reactive species\nFull Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 7\nCalculated Molecular Weight: 511 aa, 56 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC010107\nGene Symbol: SLC7A7\nGene ID (NCBI): 9056\nRRID: AB_3669533\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UM01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887807910057,"sku":"26403-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26403-1-ap","provider":"Iright","version":"1.0","type":"link"}