{"product_id":"proteintech-26456-1-ap","title":"Proteintech, 26456-1-AP, GMAP-210 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GMAP-210 (26456-1-AP) by Proteintech is a Polyclonal antibody targeting GMAP-210 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n26456-1-AP targets GMAP-210 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HL-60 cells\nPositive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGolgi microtubule-associated protein 210 (GMAP-210), also referred to as CEV14, Trip11 or Trip230, is a peripheral Golgi protein that localizes to the cis-Golgi network. GMAP-210 is a 1,978 amino acid coiled-coil member of the golgin family of proteins. Microtubule ends bind to GMAP-210 which functions to link the cis-Golgi network to the minus ends of centrosome-nucleated microtubules. This interaction may be essential for the proper morphology and structural maintenance of the Golgi apparatus. GMAP-210 also associates with thyroid hormone receptor. Overexpression of GMAP-210 disrupts the micro-tubule network and causes a significant enlargement and fragmentation of the Golgi apparatus; it also blocks anterograde and retrograde transport between the ER and the Golgi apparatus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13867 Product name: Recombinant human GMAP-210 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC002656 Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE Predict reactive species\nFull Name: thyroid hormone receptor interactor 11\nCalculated Molecular Weight: 1979 aa, 228 kDa\nObserved Molecular Weight: 230 kDa\nGenBank Accession Number: BC002656\nGene Symbol: TRIP11\nGene ID (NCBI): 9321\nRRID: AB_2880519\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15643\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998521001,"sku":"26456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26456-1-ap","provider":"Iright","version":"1.0","type":"link"}