{"product_id":"proteintech-26478-1-ap","title":"Proteintech, 26478-1-AP, MINDY3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MINDY3 (26478-1-AP) by Proteintech is a Polyclonal antibody targeting MINDY3 in IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n26478-1-AP targets MINDY3 in IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HCT 116 cells\nPositive IHC detected in: mouse kidney tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMINDY3 (also known as FAM63B) is a deubiquitinating enzyme (DUB) localized to the endoplasmic reticulum and belongs to the MINDY family. This protein specifically recognizes and cleaves lysine 48 (K48)-linked ubiquitin chains, which serve as the primary signal targeting proteins for proteasomal degradation, thereby playing a critical role in regulating protein stability. Research indicates that MINDY3 influences various cellular processes through its deubiquitination activity, including endoplasmic reticulum-associated degradation (ERAD), cellular stress response, and cell cycle regulation. Dysregulation of its function is closely associated with pathological processes such as cancer and neurodegenerative diseases, making it a potential target for therapeutic research.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23520 Product name: Recombinant human C10orf97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC067799 Sequence: MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHS Predict reactive species\nFull Name: chromosome 10 open reading frame 97\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC067799\nGene Symbol: C10orf97\nGene ID (NCBI): 80013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H8M7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719665833,"sku":"26478-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26478-1-ap","provider":"Iright","version":"1.0","type":"link"}