{"product_id":"proteintech-26501-1-ap","title":"Proteintech, 26501-1-AP, AMBN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMBN (26501-1-AP) by Proteintech is a Polyclonal antibody targeting AMBN in WB, IF\/ICC, ELISA applications with reactivity to human samples\n26501-1-AP targets AMBN in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMBN(Ameloblastin), the gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect. It is expected to be located in the Vesicles, in addition localized to the Nucleoplasm, which is enriched in brain, and located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel. The molecular weight of AMBN is 48 kDa. It also has phosphorylation modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24129 Product name: Recombinant human AMBN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-335 aa of BC106931 Sequence: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN Predict reactive species\nFull Name: ameloblastin (enamel matrix protein)\nCalculated Molecular Weight: 447 aa, 48 kDa\nObserved Molecular Weight: 48-55 kDa\nGenBank Accession Number: BC106931\nGene Symbol: AMBN\nGene ID (NCBI): 258\nRRID: AB_3669542\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP70\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869808742569,"sku":"26501-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26501-1-ap","provider":"Iright","version":"1.0","type":"link"}