{"product_id":"proteintech-26517-1-ap","title":"Proteintech, 26517-1-AP, DEPDC7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DEPDC7 (26517-1-AP) by Proteintech is a Polyclonal antibody targeting DEPDC7 in WB, ELISA applications with reactivity to human samples\n26517-1-AP targets DEPDC7 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEPDC7 (DEP domain-containing protein 7), also known as protein TR2\/D15, is a 511 amino acid protein belonging to the DEPDC7 family. DEPDC7 contains one DEP domain and is highly expressed in liver, with lower levels in kidney. DEPDC7 exists as two isoforms produced by alternative splicing events. The gene encoding DEPDC7 maps to human chromosome 11p13 and mouse chromosome 2 E2. With approximately 135 million base pairs and 1,400 genes, chromosome 11 makes up around 4% of human genomic DNA and is considered a gene and disease association dense chromosome. DEPDC7 involves the regulation of small GTPase mediated signal transduction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24094 Product name: Recombinant human DEPDC7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 344-511 aa of BC030970 Sequence: QLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD Predict reactive species\nFull Name: DEP domain containing 7\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC030970\nGene Symbol: DEPDC7\nGene ID (NCBI): 91614\nRRID: AB_2880539\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96QD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887166083241,"sku":"26517-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26517-1-ap","provider":"Iright","version":"1.0","type":"link"}