{"product_id":"proteintech-26527-1-ap","title":"Proteintech, 26527-1-AP, CCL20\/MIP-3 alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL20\/MIP-3 alpha (26527-1-AP) by Proteintech is a Polyclonal antibody targeting CCL20\/MIP-3 alpha in IHC, ELISA applications with reactivity to human samples\n26527-1-AP targets CCL20\/MIP-3 alpha in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissue,  human pancreas cancer tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24069 Product name: Recombinant human MIP-3α protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-95 aa of BC020698 Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Predict reactive species\nFull Name: chemokine (C-C motif) ligand 20\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: BC020698\nGene Symbol: CCL20\/MIP-3 alpha\nGene ID (NCBI): 6364\nRRID: AB_2880543\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78556\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932296873,"sku":"26527-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26527-1-ap","provider":"Iright","version":"1.0","type":"link"}