{"product_id":"proteintech-26554-1-ap","title":"Proteintech, 26554-1-AP, FGF9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF9 (26554-1-AP) by Proteintech is a Polyclonal antibody targeting FGF9 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n26554-1-AP targets FGF9 in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach tissue, human prostate cancer tissue,  human colon cancer tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibroblast growth factor 9 (FGF9) is a critically important and elegantly regulated growth factor that was first identified during a screen for factors acting on cells of the central nervous system (CNS). Over the subsequent two decades of research, FGF9 has been revealed to play a significant role in various biological processes. A key feature of its control is reciprocal compartmentalization, particularly during development, with the epithelium serving as a dominant source and mesenchyme as a prime target. This mesenchyme selectivity is achieved through the high affinity of FGF9 to the IIIc isoforms of FGFR1, 2, and 3. FGF9 is widely expressed in the embryo, including in the developing heart and lungs, and more selectively in adult tissues, such as the CNS and kidneys.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24244 Product name: Recombinant human FGF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC069692 Sequence: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLD Predict reactive species\nFull Name: fibroblast growth factor 9 (glia-activating factor)\nCalculated Molecular Weight: 208 aa, 23 kDa\nGenBank Accession Number: BC069692\nGene Symbol: FGF9\nGene ID (NCBI): 2254\nRRID: AB_2880550\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31371\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887639122089,"sku":"26554-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26554-1-ap","provider":"Iright","version":"1.0","type":"link"}