{"product_id":"proteintech-26582-1-ap","title":"Proteintech, 26582-1-AP, SCF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCF (26582-1-AP) by Proteintech is a Polyclonal antibody targeting SCF in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n26582-1-AP targets SCF in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, NIH\/3T3 cells,  mouse colon tissue\nPositive IHC detected in: human kidney tissue, human small intestine tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStem cell factor (SCF) also known as mast cell growth factor, steel factor, and kit ligand, is a hematopoietic growth factor. SCF is a critical protein with key roles in the cell such as hematopoiesis, gametogenesis and melanogenesis. SCF activates multiple signal pathways by binding with c-kit receptor. SCF and its receptor, c-kit ligand (KL), are up-regulated in particular human malignancies including gastrointestinal stromal tumor (GISTs),  breast cancer, hematopoietic cell, myeloid leukaemia, and glioma. The SCF\/c-KIT system also plays a relevant role in cell fate decision, and its activity is widely known to control cell proliferation, differentiation, survival and apoptosis. SCF is a 35 to 45 kDa monomeric glycoprotein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25075 Product name: Recombinant human SCF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-214 aa of BC074725 Sequence: ICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH Predict reactive species\nFull Name: KIT ligand\nCalculated Molecular Weight: 273 aa, 31 kDa\nObserved Molecular Weight: 30-45 kDa\nGenBank Accession Number: BC074725\nGene Symbol: SCF\nGene ID (NCBI): 4254\nRRID: AB_2880561\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21583\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903690409,"sku":"26582-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26582-1-ap","provider":"Iright","version":"1.0","type":"link"}