{"product_id":"proteintech-26593-1-ap","title":"Proteintech, 26593-1-AP, Bcl2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Bcl2 (26593-1-AP) by Proteintech is a Polyclonal antibody targeting Bcl2 in WB, IHC, FC (Intra), ELISA applications with reactivity to mouse, rat samples\n26593-1-AP targets Bcl2 in WB, IHC, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, C2C12 cells,  mouse brain tissue,  mouse heart tissue,  mouse testis tissue,  mouse kidney tissue,  mouse spleen tissue,  rat spleen tissue,  rat spleen tissue.,  rat kidney tissue,  rat testis tissue,  mouse colon tissue\nPositive IHC detected in: mouse spleen tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\n1.       What is Bcl-2?Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.2.       FAQs for Bcl-2How to measure Bcl-2 and Bax apoptotic markers by western blottingGenerally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.What band sizeshouldI expect in western blotting for Bcl-2?The molecular weight of Bcl-2 is 26 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse, rat, pig, rabbit, canine, chicken, bovine, hamster, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24260 Product name: Recombinant mouse Bcl2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of NM-009741 Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species\nFull Name: B-cell leukemia\/lymphoma 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: NM-009741\nGene Symbol: Bcl2\nGene ID (NCBI): 12043\nRRID: AB_2818996\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10417\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887965687977,"sku":"26593-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26593-1-ap","provider":"Iright","version":"1.0","type":"link"}