{"product_id":"proteintech-26600-1-ap","title":"Proteintech, 26600-1-AP, STK17B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK17B (26600-1-AP) by Proteintech is a Polyclonal antibody targeting STK17B in WB, IHC, ELISA applications with reactivity to human samples\n26600-1-AP targets STK17B in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells,  HepG2 cells,  K-562 cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerine\/threonine kinase 17B (STK17B), also named as DRAK2, whose gene is located on chromosome 2 (2q32.3), was first reported by Sanjo et al. in 1998 (PMID: 9786912). STK17B has been identified as a promising therapeutic target for type 1 diabetes, multiple sclerosis, and graft rejection. There are also some reports demonstrated that STK17B was related to apoptosis in various cell types, such as islet β-cells and acute myeloid leukemia cells. Some researches revealed that STK17B was deregulated in some cancers and have important role in cancer progression (PMID: 29445189). It has an indispensable role in NAFLD\/NASH and offer a potential therapeutic arget for this disease (PMID: 34614409).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24389 Product name: Recombinant human STK17B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 250-372 aa of BC016040 Sequence: VNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC Predict reactive species\nFull Name: serine\/threonine kinase 17b\nCalculated Molecular Weight: 372 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC016040\nGene Symbol: STK17B\nGene ID (NCBI): 9262\nRRID: AB_2880570\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94768\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869609250985,"sku":"26600-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26600-1-ap","provider":"Iright","version":"1.0","type":"link"}