{"product_id":"proteintech-26605-1-ap","title":"Proteintech, 26605-1-AP, XCL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XCL1 (26605-1-AP) by Proteintech is a Polyclonal antibody targeting XCL1 in WB, IHC, ELISA applications with reactivity to human samples\n26605-1-AP targets XCL1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, Ionomycin and Brefeldin A treated NK-92 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXCL1 also known as Lymphotactin, is a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24258 Product name: Recombinant human XCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-114 aa of BC070309 Sequence: SEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Predict reactive species\nFull Name: chemokine (C motif) ligand 1\nCalculated Molecular Weight: 114 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC070309\nGene Symbol: XCL1\nGene ID (NCBI): 6375\nRRID: AB_3669553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47992\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887924826281,"sku":"26605-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26605-1-ap","provider":"Iright","version":"1.0","type":"link"}