{"product_id":"proteintech-26611-1-ap","title":"Proteintech, 26611-1-AP, SLC26A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC26A1 (26611-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A1 in WB, IP, ELISA applications with reactivity to human, mouse samples\n26611-1-AP targets SLC26A1 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse spleen tissue\nPositive IP detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24306 Product name: Recombinant human SLC26A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-70 aa of BC015517 Sequence: MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWLRQYRPREYLA Predict reactive species\nFull Name: solute carrier family 26 (sulfate transporter), member 1\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 70 kDa~85 kDa\nGenBank Accession Number: BC015517\nGene Symbol: SLC26A1\nGene ID (NCBI): 10861\nRRID: AB_2880574\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2B4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869602435241,"sku":"26611-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26611-1-ap","provider":"Iright","version":"1.0","type":"link"}