{"product_id":"proteintech-26630-1-ap","title":"Proteintech, 26630-1-AP, CLRN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLRN1 (26630-1-AP) by Proteintech is a Polyclonal antibody targeting CLRN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26630-1-AP targets CLRN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: mouse testis tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24289 Product name: Recombinant human CLRN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 156-232 aa of BC074970 Sequence: ASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY Predict reactive species\nFull Name: clarin 1\nCalculated Molecular Weight: 232 aa, 26 kDa\nObserved Molecular Weight: 23 kDa, 27 kDa\nGenBank Accession Number: BC074970\nGene Symbol: CLRN1\nGene ID (NCBI): 7401\nRRID: AB_2880579\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58418\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869657256105,"sku":"26630-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26630-1-ap","provider":"Iright","version":"1.0","type":"link"}