{"product_id":"proteintech-26632-1-ap","title":"Proteintech, 26632-1-AP, DUOXA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUOXA1 (26632-1-AP) by Proteintech is a Polyclonal antibody targeting DUOXA1 in WB, ELISA applications with reactivity to human,  mouse samples\n26632-1-AP targets DUOXA1 in WB, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue,  Jurkat cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUOXA1, also named as NIP and NUMBIP, originally identified as a Numb-interacting protein, was recently shown to function as a maturation factor for the dual oxidase 1(DUOX1). DUOXA1 transient overexpression affected the cell-cell adhesion by modulating the actin cytoskeleton, and sensitized cells to doxorubicin. DUOXA1 has some isoforms with MW 33 kDa, 38 kDa and 54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24373 Product name: Recombinant human DUOXA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-298 aa of BC020841 Sequence: GYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL Predict reactive species\nFull Name: dual oxidase maturation factor 1\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 29 kDa, 52 kDa\nGenBank Accession Number: BC020841\nGene Symbol: DUOXA1\nGene ID (NCBI): 90527\nRRID: AB_2880581\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q1HG43\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869676916905,"sku":"26632-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26632-1-ap","provider":"Iright","version":"1.0","type":"link"}