{"product_id":"proteintech-26646-1-ap","title":"Proteintech, 26646-1-AP, MBOAT7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MBOAT7 (26646-1-AP) by Proteintech is a Polyclonal antibody targeting MBOAT7 in WB, ELISA applications with reactivity to human, mouse samples\n26646-1-AP targets MBOAT7 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMBOAT7 (membrane-bound O-acyltransferase domain containing 7), also known as LPIAT, LENG4, or BB1, belongs to the MBOAT superfamily. MBOAT7 acylates lyso-phosphatidylinositol (lyso-PI) with arachidonyl-CoA and is involved in phosphatidylinositol acyl-chain remodeling in the Lands cycle (PMID: 30959108; PMID: 35509994). MBOAT7 deficiency in humans leads to developmental disorders of the central nervous system, with intellectual disability, epilepsy, and autism spectrum disorder (PMID: 37316513). This antibody ditects all the isoforms of MBOA7 with MW 53 kDa, 40-44 kDa and 38 kDa. With modifications, the MW is even higher.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24490 Product name: Recombinant human MBOAT7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 284-344 aa of BC006309 Sequence: SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR Predict reactive species\nFull Name: membrane bound O-acyltransferase domain containing 7\nCalculated Molecular Weight: 472 aa, 53 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC006309\nGene Symbol: MBOAT7\nGene ID (NCBI): 79143\nRRID: AB_3085890\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96N66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887714521257,"sku":"26646-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26646-1-ap","provider":"Iright","version":"1.0","type":"link"}