{"product_id":"proteintech-26691-1-ap","title":"Proteintech, 26691-1-AP, P3H1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe P3H1 (26691-1-AP) by Proteintech is a Polyclonal antibody targeting P3H1 in WB, IHC, ELISA applications with reactivity to human samples\n26691-1-AP targets P3H1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human testis tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nP3H1 (prolyl 3-hydroxylase 1, also known as LEPRE1) is a member of the leprecan family of proteins, which also include P3H2, P3H3, CRTAP and SC56. Collagen prolyl hydroxylases are required for proper collagen biosynthesis, folding, and assembly. P3H1 is localized to the endoplasmic reticulum and has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. Mutations in this gene are associated with osteogenesis imperfecta type VIII.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24904 Product name: Recombinant human LEPRE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-109 aa of BC108311 Sequence: EVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRSRAALRALRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSF Predict reactive species\nFull Name: leucine proline-enriched proteoglycan (leprecan) 1\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC108311\nGene Symbol: LEPRE1\/P3H1\nGene ID (NCBI): 64175\nRRID: AB_2880605\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q32P28\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869479555241,"sku":"26691-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26691-1-ap","provider":"Iright","version":"1.0","type":"link"}