{"product_id":"proteintech-26727-1-ap","title":"Proteintech, 26727-1-AP, SNX10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX10 (26727-1-AP) by Proteintech is a Polyclonal antibody targeting SNX10 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26727-1-AP targets SNX10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. Mutations in SNX10 (Sorting nexin-10) have been found to account for approximately 4% of all human autosomal recessive osteopetrosis (ARO) that is a genetically heterogeneous disorder caused by reduced bone resorption by osteoclasts (PMID: 23280965; PMID: 28592808).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24977 Product name: Recombinant human SNX10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-201 aa of BC034992 Sequence: HLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES Predict reactive species\nFull Name: sorting nexin 10\nCalculated Molecular Weight: 201 aa, 24 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC034992\nGene Symbol: SNX10\nGene ID (NCBI): 29887\nRRID: AB_3085897\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5X0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887811154089,"sku":"26727-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26727-1-ap","provider":"Iright","version":"1.0","type":"link"}