{"product_id":"proteintech-26731-1-ap","title":"Proteintech, 26731-1-AP, SLC17A9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC17A9 (26731-1-AP) by Proteintech is a Polyclonal antibody targeting SLC17A9 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n26731-1-AP targets SLC17A9 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, C2C12 cells,  fetal human brain tissue,  mouse brain tissue,  Caco-2 cells,  THP-1 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species\nFull Name: solute carrier family 17, member 9\nCalculated Molecular Weight: 436 aa, 47 kDa\nObserved Molecular Weight: 68-70 kDa\nGenBank Accession Number: BC025312\nGene Symbol: SLC17A9\nGene ID (NCBI): 63910\nRRID: AB_2880617\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869430665385,"sku":"26731-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26731-1-ap","provider":"Iright","version":"1.0","type":"link"}