{"product_id":"proteintech-26738-1-ap","title":"Proteintech, 26738-1-AP, CENPB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CENPB (26738-1-AP) by Proteintech is a Polyclonal antibody targeting CENPB in WB, ELISA applications with reactivity to human, mouse samples\n26738-1-AP targets CENPB in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCentromere protein B (CENPB), also known as major centromere autoantigen B, is an autoantigen protein of the cell nucleus. In mammalian centromeres CENPB plays a critical role in the organization of chromatinstructure, but in the absence of CENPB some chromosomes use other redundant proteins to accomplish mitosis (PMID: 14963831). CENPB plays an important role in cell cycle regulation. CENPB is highly expressed in cancer cells helping in high rate proliferation. This antibody detects CENPB protein with a molecular weight of 80 kDa (PMID: 34547289, PMID: 29273057).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24967 Product name: Recombinant human CENPB protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-180 aa of BC053847 Sequence: MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPP Predict reactive species\nFull Name: centromere protein B, 80kDa\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC053847\nGene Symbol: CENPB\nGene ID (NCBI): 1059\nRRID: AB_3085899\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07199\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886450987177,"sku":"26738-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26738-1-ap","provider":"Iright","version":"1.0","type":"link"}