{"product_id":"proteintech-26743-1-ap","title":"Proteintech, 26743-1-AP, CCNJL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCNJL (26743-1-AP) by Proteintech is a Polyclonal antibody targeting CCNJL in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26743-1-AP targets CCNJL in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25048 Product name: Recombinant human CCNJL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-52 aa of BC013353 Sequence: PALGQPATTLAQFQTPVQDLCLAYRDSLQAHRS Predict reactive species\nFull Name: cyclin J-like\nCalculated Molecular Weight: 435 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC013353\nGene Symbol: CCNJL\nGene ID (NCBI): 79616\nRRID: AB_3085900\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IV13\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886029295785,"sku":"26743-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26743-1-ap","provider":"Iright","version":"1.0","type":"link"}