{"product_id":"proteintech-26763-1-ap","title":"Proteintech, 26763-1-AP, OLIG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OLIG1 (26763-1-AP) by Proteintech is a Polyclonal antibody targeting OLIG1 in WB, ELISA applications with reactivity to human, mouse samples\n26763-1-AP targets OLIG1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe oligodendrocyte lineage-specific basic helix-loop-helix (OLIG) family of transcription factors includes OLIG1-OLIG3, which differ in tissue expression. OLIG1 and OLIG2 are specifically expressed in nervous tissue as gene regulators of oligodendrogenesis. OLIG1 and OLIG2 interact with the Nkx-2.2 homeodomain protein, which is responsible for directing ventral neuronal patterning in response to graded Sonic hedgehog signaling in the embryonic neural tube. These interactions between OLIG proteins and Nkx-2.2 appear to promote the formation of alternate cell types by inhibiting V3 interneuron development. OLIG1 and OLIG2 are abundantly expressed in oligodendroglioma and nearly absent in astrocytomas. Therefore, OLIG proteins are candidates for molecular markers of human glial brain tumors, which are the most common primary malignancies of the human brain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25128 Product name: Recombinant human OLIG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC026989 Sequence: MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQ Predict reactive species\nFull Name: oligodendrocyte transcription factor 1\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC026989\nGene Symbol: OLIG1\nGene ID (NCBI): 116448\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887745716393,"sku":"26763-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26763-1-ap","provider":"Iright","version":"1.0","type":"link"}