{"product_id":"proteintech-26769-1-ap","title":"Proteintech, 26769-1-AP, HNRPLL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HNRPLL (26769-1-AP) by Proteintech is a Polyclonal antibody targeting HNRPLL in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n26769-1-AP targets HNRPLL in WB, IHC, IF\/ICC, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  K-562 cells\nPositive IHC detected in: mouse kidney tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHNRPLL, also named as HNRNPLL and SRRF, is an RNA binding protein that regulates alternative splicing of pre-mRNA. HnRNPLL is up-regulated in stimulated T cells, bound CD45 transcripts, and is a key inducible regulator of CD45 alternative splicing (PMID: 18669861). HNRPLL has 5 isoforms with the molecular weights of 31-60 kDa. Additionally, studies have shown that HNRPLL is a metastasis suppressor gene in colorectal cancer  (PMID: 28360095).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25287 Product name: Recombinant human HNRPLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC017480 Sequence: MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH Predict reactive species\nFull Name: heterogeneous nuclear ribonucleoprotein L-like\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC017480\nGene Symbol: HNRPLL\nGene ID (NCBI): 92906\nRRID: AB_2880628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVV9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869465366697,"sku":"26769-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26769-1-ap","provider":"Iright","version":"1.0","type":"link"}