{"product_id":"proteintech-26782-1-ap","title":"Proteintech, 26782-1-AP, TMBIM6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMBIM6 (26782-1-AP) by Proteintech is a Polyclonal antibody targeting TMBIM6 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n26782-1-AP targets TMBIM6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24780 Product name: Recombinant human TMBIM6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-86 aa of BC000916 Sequence: MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG Predict reactive species\nFull Name: transmembrane BAX inhibitor motif containing 6\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC000916\nGene Symbol: TMBIM6\nGene ID (NCBI): 7009\nRRID: AB_2880633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55061\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868974600361,"sku":"26782-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26782-1-ap","provider":"Iright","version":"1.0","type":"link"}