{"product_id":"proteintech-26793-1-ap","title":"Proteintech, 26793-1-AP, SIPA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIPA1 (26793-1-AP) by Proteintech is a Polyclonal antibody targeting SIPA1 in WB, IHC, ELISA applications with reactivity to human samples\n26793-1-AP targets SIPA1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HEK-293T cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIPA1 (Signal-induced proliferation-associated protein 1) is also named as SPA1, p130 SPA-1 and GTPase-activating protein Spa-1. SIPA1, a GTPase activating protein, was discovered in proliferating lymphocytes as mitogen-induced nuclear protein. SIPA1 promotes catalyzation of hydrolyze Rap1GTP\/GDP and is known to be a negative regulator of Ras-related protein, which transduces the signals for various cellular functions, including development, cellular proliferation, and cellular adhesion (PMID:28237246). Transcription of fibronectin 1, which is crucial for cell junction and migration of triple-negative breast cancer (TNBC) cells, was regulated by SIPA1 in a DBR-dependent manner. SIPA1 was highly expressed in metastatic TNBC. SIPA1 served as a TF, promoting TNBC migration, invasion, and metastasis (PMID: 37500797).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25383 Product name: Recombinant human SIPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1042 aa of BC010492 Sequence: GQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA Predict reactive species\nFull Name: signal-induced proliferation-associated 1\nCalculated Molecular Weight: 1042 aa, 112 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC010492\nGene Symbol: SIPA1\nGene ID (NCBI): 6494\nRRID: AB_2880637\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96FS4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869764178089,"sku":"26793-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26793-1-ap","provider":"Iright","version":"1.0","type":"link"}