{"product_id":"proteintech-26808-1-ap","title":"Proteintech, 26808-1-AP, MS4A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MS4A2 (26808-1-AP) by Proteintech is a Polyclonal antibody targeting MS4A2 in WB, ELISA applications with reactivity to human, mouse samples\n26808-1-AP targets MS4A2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMS4A is a new gene family with four transmembrane-spanning domains and is crucial for cell differentiation, signaling, and cell cycle control. The membrane-spanning 4 domains, superfamily A, number 2 gene (MS4A2, also named as the beta-chain of the high affinity IgE receptor or FcεRIβ gene, FCER1B), as a member of the MS4A family, is a component of the high-affinity IgE receptor, with co-immunoprecipitation experiments demonstrating that it associates with FcɛRIα and FcRγ to form a tetrameric receptor complex (αβγ2) that is expressed on mast cells and basophils at high density(PMID: 25835430). MS4A2 is strongly associated with the prognosis of lung adenocarcinoma and lung cancer brain metastases(PMID: 37533433).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25196 Product name: Recombinant human MS4A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC074843 Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDI Predict reactive species\nFull Name: membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide)\nCalculated Molecular Weight: 244 aa, 27 kDa\nObserved Molecular Weight: 25-27 kDa\nGenBank Accession Number: BC074843\nGene Symbol: MS4A2\nGene ID (NCBI): 2206\nRRID: AB_3085906\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01362\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887725465769,"sku":"26808-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26808-1-ap","provider":"Iright","version":"1.0","type":"link"}