{"product_id":"proteintech-26812-1-ap","title":"Proteintech, 26812-1-AP, CLCN5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLCN5 (26812-1-AP) by Proteintech is a Polyclonal antibody targeting CLCN5 in WB, IHC, ELISA applications with reactivity to human,  Canine, mouse samples\n26812-1-AP targets CLCN5 in WB, IHC, IF, ELISA applications and shows reactivity with human,  Canine, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDCK cells, mouse brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, Canine, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25182 Product name: Recombinant human CLCN5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 627-685 aa of BC130429 Sequence: ESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDL Predict reactive species\nFull Name: chloride channel 5\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 80-90 kDa\nGenBank Accession Number: BC130429\nGene Symbol: CLCN5\nGene ID (NCBI): 1184\nRRID: AB_2880643\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P51795\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869656469673,"sku":"26812-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26812-1-ap","provider":"Iright","version":"1.0","type":"link"}