{"product_id":"proteintech-26827-1-ap","title":"Proteintech, 26827-1-AP, SLC12A9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC12A9 (26827-1-AP) by Proteintech is a Polyclonal antibody targeting SLC12A9 in WB, ELISA applications with reactivity to human, mouse samples\n26827-1-AP targets SLC12A9 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  LNCaP cells,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC12A9, also known as CCC6 and CIP1, belongs to the SLC12A transporter family. SLC12A9 encodes a 914 amino acid protein with predicted 12 TM domains, two N-glycosylation sites between TM5 and TM6, and a carboxyl terminus PKC phosphorylation site (PMID: 23506871). SLC12A9 regulates ion gradients across renal tubules and maintains cell volume (PMID: 27530302). SLC12A9 is highly expressed in placenta, brain, and kidney.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25351 Product name: Recombinant human SLC12A9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 417-538 aa of BC000154 Sequence: QALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPRGALPLLRLANQLKKGGLYVLGHVTLGDLDSLPSDPVQPQYGAWLSLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLESNSHPLP Predict reactive species\nFull Name: solute carrier family 12 (potassium\/chloride transporters), member 9\nCalculated Molecular Weight: 96 kDa\nObserved Molecular Weight: 101 kDa\nGenBank Accession Number: BC000154\nGene Symbol: SLC12A9\nGene ID (NCBI): 56996\nRRID: AB_3085908\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXP2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803519145,"sku":"26827-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26827-1-ap","provider":"Iright","version":"1.0","type":"link"}