{"product_id":"proteintech-26841-1-ap","title":"Proteintech, 26841-1-AP, FLVCR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FLVCR1 (26841-1-AP) by Proteintech is a Polyclonal antibody targeting FLVCR1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n26841-1-AP targets FLVCR1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells,  human placenta tissue,  K-562 cells,  mouse kidney tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human breast cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFLVCR1(feline leukemia virus subgroup C receptor 1) has been reported to have a crucial role in a variety of biological processes, including cell proliferation, cell death, apoptosis, oxidative stress response, cellular differentiation, and metabolism (PMID: 29532854). In addition, FLVCR1 can be applied as a clinical prognostic marker for patients with ESCC (PMID: 33842377).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25220 Product name: Recombinant human FLVCR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC048312 Sequence: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGPPRDSLAAASGVLGGPQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRR Predict reactive species\nFull Name: feline leukemia virus subgroup C cellular receptor 1\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa~70 kDa\nGenBank Accession Number: BC048312\nGene Symbol: FLVCR1\nGene ID (NCBI): 28982\nRRID: AB_2880654\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5Y0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869406843049,"sku":"26841-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26841-1-ap","provider":"Iright","version":"1.0","type":"link"}