{"product_id":"proteintech-26846-1-ap","title":"Proteintech, 26846-1-AP, TRAF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAF2 (26846-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF2 in WB, ELISA applications with reactivity to human samples\n26846-1-AP targets TRAF2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  human testis tissue,  Jurkat cells,  MOLT-4 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression through multiple pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, bovine, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species\nFull Name: TNF receptor-associated factor 2\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC032410\nGene Symbol: TRAF2\nGene ID (NCBI): 7186\nRRID: AB_2880656\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12933\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849950889,"sku":"26846-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26846-1-ap","provider":"Iright","version":"1.0","type":"link"}