{"product_id":"proteintech-26855-1-ap","title":"Proteintech, 26855-1-AP, LTBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LTBP1 (26855-1-AP) by Proteintech is a Polyclonal antibody targeting LTBP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n26855-1-AP targets LTBP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLatent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) is a large extracellular matrix protein that belongs to the latent TGF-beta binding protein family. It plays a crucial role in the regulation of TGF-beta, a multifunctional cytokine involved in various cellular processes such as cell growth, differentiation, and immune response. LTBP1 is essential for TGF-beta folding, secretion, matrix localization, and activation. It forms latent complexes with TGF-beta by covalently binding the TGF-beta propeptide (LAP) via disulfide bonds in the endoplasmic reticulum. This complex is then secreted and targeted to the extracellular matrix, where TGF-beta can be activated by various mechanism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25392 Product name: Recombinant human LTBP1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 600-739 aa of BC130289 Sequence: CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH Predict reactive species\nFull Name: latent transforming growth factor beta binding protein 1\nCalculated Molecular Weight: 1721 aa, 187 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC130289\nGene Symbol: LTBP1\nGene ID (NCBI): 4052\nRRID: AB_2880658\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14766\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934656169,"sku":"26855-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26855-1-ap","provider":"Iright","version":"1.0","type":"link"}