{"product_id":"proteintech-26859-1-ap","title":"Proteintech, 26859-1-AP, RFX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RFX1 (26859-1-AP) by Proteintech is a Polyclonal antibody targeting RFX1 in WB, IP, ELISA applications with reactivity to human samples\n26859-1-AP targets RFX1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HL-60 cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRFX1, also named as MHC class II regulatory factor RFX1, is a 979 amino acid protein which contains 1 RFX-type winged-helix DNA-binding domain and belongs to the RFX family. RFX1 can binds DNA as a homodimer and heterodimerizes with RFX2 and RFX3. RFX1 as a regulatory factor is essential for MHC class II genes expression. RFX1 protein is modified after translation and its molecular weight could be migrate to 130-140 kDa (PMID: 20189986 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25442 Product name: Recombinant human RFX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 62-289 aa of BC049826 Sequence: QPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQGTQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPH Predict reactive species\nFull Name: regulatory factor X, 1 (influences HLA class II expression)\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 135 kDa\nGenBank Accession Number: BC049826\nGene Symbol: RFX1\nGene ID (NCBI): 5989\nRRID: AB_2880659\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22670\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869582053545,"sku":"26859-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26859-1-ap","provider":"Iright","version":"1.0","type":"link"}