{"product_id":"proteintech-26903-1-ap","title":"Proteintech, 26903-1-AP, CD86 (C-terminal) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD86 (C-terminal) (26903-1-AP) by Proteintech is a Polyclonal antibody targeting CD86 (C-terminal) in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n26903-1-AP targets CD86 (C-terminal) in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cell,  Ramos cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25432 Product name: Recombinant human CD86 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-329 aa of BC040261 Sequence: WKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDETQRVFKSSKTSSCDKSDTCF Predict reactive species\nFull Name: CD86 molecule\nCalculated Molecular Weight: 329 aa, 38 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC040261\nGene Symbol: CD86\nGene ID (NCBI): 942\nENSEMBL Gene ID: ENSG00000114013\nRRID: AB_2880677\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42081\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839694505,"sku":"26903-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26903-1-ap","provider":"Iright","version":"1.0","type":"link"}