{"product_id":"proteintech-26912-1-ap","title":"Proteintech, 26912-1-AP, Claudin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 2 (26912-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 2 in WB, ELISA applications with reactivity to human samples\n26912-1-AP targets Claudin 2 in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  Caco-2 cells,  HT-29 cells,  HepG2 cells,  PANC-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudin 2, also named as SP82, belongs to the claudin family. Claudin 2 is a tetraspan membrane protein consisting of two extracellular domains (ECL1 and ECL2), a small intracellular loop connecting the second and third transmembrane sections and short intracellular N and C terminal portions. Claudin 2 is a cation-selective channel forming TJ protein expressed in leaky epithelia. Claudin 2 is a 230 amino acid transmembrane protein, with a calculated molecular mass of 25 kDa (PMID: 31726679)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25527 Product name: Recombinant human CLDN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-230 aa of BC014424 Sequence: SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV Predict reactive species\nFull Name: claudin 2\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC014424\nGene Symbol: Claudin 2\nGene ID (NCBI): 9075\nRRID: AB_2918115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P57739\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901167273,"sku":"26912-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26912-1-ap","provider":"Iright","version":"1.0","type":"link"}