{"product_id":"proteintech-26931-1-ap","title":"Proteintech, 26931-1-AP, Filaggrin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Filaggrin (26931-1-AP) by Proteintech is a Polyclonal antibody targeting Filaggrin in IHC, ELISA applications with reactivity to human samples\n26931-1-AP targets Filaggrin in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human paracancerous of skin squamous cell cancer tissue, human skin squamous cell cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProfilaggrin is a major protein component of the keratohyalin granules of mammalian epidermis. It is initially expressed as a large polyprotein precursor, which is subsequently proteolytically processed into individual functional filaggrin molecules. The free filaggrin binds to keratin intermediate filaments, causing their aggregation into macrofibrils in which the intermediate filaments are aligned in tightly packed parallel arrays. Mutations in Filaggrin are associated with Ichthyosis vulgaris and Dermatitis atopic 2.(PMID: 19386895, 16550169)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25389 Product name: Recombinant human Filaggrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of NM_002016 Sequence: MRKENLPISGHKHRKHSHHDKHEDNKQEENKENRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNSSKKEKNKTEN Predict reactive species\nFull Name: filaggrin\nCalculated Molecular Weight: 435 kDa\nGenBank Accession Number: NM_002016\nGene Symbol: FLG\nGene ID (NCBI): 2312\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20930\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887640793257,"sku":"26931-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26931-1-ap","provider":"Iright","version":"1.0","type":"link"}