{"product_id":"proteintech-26932-1-ap","title":"Proteintech, 26932-1-AP, LMO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LMO1 (26932-1-AP) by Proteintech is a Polyclonal antibody targeting LMO1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26932-1-AP targets LMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLOM1 (LIM Domain Only 1), as a Protein Coding gene, encodes a cysteine-rich, two LIM domain transcriptional regulator. It may be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL)(Uniprot). Diseases associated with LMO1 include T-Cell Acute Lymphoblastic Leukemia and Neuroblastoma (PMID:31830377). The downstream of LMO1-regulatory cascade includes a tumor-promoting LIMS1\/ILK pathway, which has a potential to be a novel therapeutic target(PMID: 29695398). The molecular weight of LMO1 is 18 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25607 Product name: Recombinant human LMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-83 aa of BC069793 Sequence: PMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG Predict reactive species\nFull Name: LIM domain only 1 (rhombotin 1)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC069793\nGene Symbol: LMO1\nGene ID (NCBI): 4004\nRRID: AB_3085916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25800\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887705346217,"sku":"26932-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26932-1-ap","provider":"Iright","version":"1.0","type":"link"}