{"product_id":"proteintech-26948-1-ap","title":"Proteintech, 26948-1-AP, USP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP7 (26948-1-AP) by Proteintech is a Polyclonal antibody targeting USP7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26948-1-AP targets USP7 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, U2OS cells,  K-562 cells,  mouse spleen tissue,  NIH\/3T3 cells,  PC-12 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25634 Product name: Recombinant human USP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species\nFull Name: ubiquitin specific peptidase 7 (herpes virus-associated)\nObserved Molecular Weight: 126-128 kDa\nGene Symbol: USP7\nGene ID (NCBI): 7874\nRRID: AB_2880696\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q93009\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868946387113,"sku":"26948-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26948-1-ap","provider":"Iright","version":"1.0","type":"link"}