{"product_id":"proteintech-26954-1-ap","title":"Proteintech, 26954-1-AP, OR2H1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OR2H1 (26954-1-AP) by Proteintech is a Polyclonal antibody targeting OR2H1 in IHC, ELISA applications with reactivity to human samples\n26954-1-AP targets OR2H1 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOlfactory receptors (ORs) are part of the G protein-coupled receptor (GPCR) superfamily. Olfactory receptors  interact with odor molecules in the nose, initiating neuronal responses that lead to olfactory perception. Olfactory receptor, family 2, subfamily H, member 1(OR2H1) is widely expressed in solid epithelial tumors but not in other normal human tissues except testis (PMID: 35499393).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25268 Product name: Recombinant human OR2H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-170 aa of BC048991 Sequence: LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ Predict reactive species\nFull Name: olfactory receptor, family 2, subfamily H, member 1\nCalculated Molecular Weight: 35 kDa\nGenBank Accession Number: BC048991\nGene Symbol: OR2H1\nGene ID (NCBI): 26716\nRRID: AB_3669577\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZK4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746502825,"sku":"26954-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26954-1-ap","provider":"Iright","version":"1.0","type":"link"}