{"product_id":"proteintech-27013-1-ap","title":"Proteintech, 27013-1-AP, TRIM26 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM26 (27013-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM26 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n27013-1-AP targets TRIM26 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse testis tissue,  RAW 264.7 cells,  HeLa cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human pancreas cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM26 is a member of the tripartite motif (TRIM) protein family composed of more than 70 members in human. TRIM proteins share a similar characteristic structure, which includes a RING (R) domain, one or two B-boxes (B), and a coiled coil (CC) domain in the N-terminal and a domain in the C-terminal with variable structures. TRIM26 potentiates virus-triggered IRF3, NF-κB activation, IFN-β induction, and cellular antiviral responses. Further investigation suggests that TRIM26 plays an important role in the antiviral innate immune response by bridging TBK1 to NEMO and mediating TBK1 activation. (PMID: 25763818, PMID: 26611359)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25546 Product name: Recombinant human TRIM26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-270 aa of BC024039 Sequence: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW Predict reactive species\nFull Name: tripartite motif-containing 26\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC024039\nGene Symbol: TRIM26\nGene ID (NCBI): 7726\nRRID: AB_2880721\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12899\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930986153,"sku":"27013-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27013-1-ap","provider":"Iright","version":"1.0","type":"link"}