{"product_id":"proteintech-27019-1-ap","title":"Proteintech, 27019-1-AP, SVCT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SVCT2 (27019-1-AP) by Proteintech is a Polyclonal antibody targeting SVCT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27019-1-AP targets SVCT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, Neuro-2a cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25504 Product name: Recombinant human SLC23A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-92 aa of BC013112 Sequence: MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYT Predict reactive species\nFull Name: solute carrier family 23 (nucleobase transporters), member 2\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC013112\nGene Symbol: SLC23A2\nGene ID (NCBI): 9962\nRRID: AB_2918116\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGH3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869609939113,"sku":"27019-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27019-1-ap","provider":"Iright","version":"1.0","type":"link"}