{"product_id":"proteintech-27055-1-ap","title":"Proteintech, 27055-1-AP, Cytokeratin 73 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 73 (27055-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 73 in WB, ELISA applications with reactivity to human, rat samples\n27055-1-AP targets Cytokeratin 73 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25716 Product name: Recombinant human KRT73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-45 aa of BC109212 Sequence: MSRQFTYKSGPAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSS Predict reactive species\nFull Name: keratin 73\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC109212\nGene Symbol: KRT73\nGene ID (NCBI): 319101\nRRID: AB_3085921\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86Y46\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887054803113,"sku":"27055-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27055-1-ap","provider":"Iright","version":"1.0","type":"link"}