{"product_id":"proteintech-27099-1-ap","title":"Proteintech, 27099-1-AP, RUNX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RUNX3 (27099-1-AP) by Proteintech is a Polyclonal antibody targeting RUNX3 in WB, ELISA applications with reactivity to human samples\n27099-1-AP targets RUNX3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRUNX3, also known as AML2, CBFA3 and PEBP2A3, is a member of the RUNX family of transcription factors, which are crucial regulators of embryonic development and play key roles in various biological processes such as cell proliferation, apoptosis, differentiation and lineage commitment (PMID: 38430423). This protein functions as a tumour suppressor and is frequently deleted or transcriptionally silenced in various cancers, including gastric and colon cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24339 Product name: Recombinant human RUNX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-251 aa of BC013362 Sequence: PFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTS Predict reactive species\nFull Name: runt-related transcription factor 3\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC013362\nGene Symbol: RUNX3\nGene ID (NCBI): 864\nRRID: AB_2880754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13761\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869428076713,"sku":"27099-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27099-1-ap","provider":"Iright","version":"1.0","type":"link"}