{"product_id":"proteintech-27131-1-ap","title":"Proteintech, 27131-1-AP, FAM3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM3B (27131-1-AP) by Proteintech is a Polyclonal antibody targeting FAM3B in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27131-1-AP targets FAM3B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human milk tissue\nPositive IHC detected in: human pancreas tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM3B, also known as Pancreatic-derived factor (PANDER), is a secreted glycoprotein that belongs to the cytokine like-protein family. There are four members in this gene family (FAM3A, FAM3B, FAM3C and FAM3D). As a result of alternative splicing and alternate signal peptide cleavage sites, multiple isoforms are known. FAM3B is selectively expressed at a high level in pancreatic islets and at low levels in the small intestine, prostate, and certain neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25955 Product name: Recombinant human FAM3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-235 aa of BC057829 Sequence: RQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS Predict reactive species\nFull Name: family with sequence similarity 3, member B\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa, 23 kDa\nGenBank Accession Number: BC057829\nGene Symbol: FAM3B\nGene ID (NCBI): 54097\nRRID: AB_2880766\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58499\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869539291305,"sku":"27131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27131-1-ap","provider":"Iright","version":"1.0","type":"link"}