{"product_id":"proteintech-27159-1-ap","title":"Proteintech, 27159-1-AP, TBXA2R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBXA2R (27159-1-AP) by Proteintech is a Polyclonal antibody targeting TBXA2R in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27159-1-AP targets TBXA2R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, DU 145 cells,  human placenta tissue,  MCF-7 cells,  PC-3 cells,  Hela cells\nPositive IHC detected in: human prostate cancer tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTBXA2R, also named as thromboxane A2 receptor, TXA2-R and Prostanoid TP receptor, belongs to G-protein coupled receptor 1 family. Thromboxane A2 receptor is a key molecule in hemostasis as its abnormality leads to bleeding disorders. The TXA2-R receptor is linked via a guanine nucleotide-binding protein (G protein) to phospholipase C (PLC), which hydrolyses phosphoinositides to the two potent stimulatory second messengers inositol 1,4,5-triphosphate (IP3) and diacylglycerol. IP3 causes increases in cytoplasmic free calcium and diacylglycerol causes activation of protein kinase C. In the kidney, the binding of TXA2-R to glomerular TP receptors causes intense vasoconstriction. The two isoforms expressed in cultured cells show similar ligand binding characteristics and phospholipase C (PLC) activation but oppositely regulate adenylyl cyclase activity (PMID: 8613548).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25670 Product name: Recombinant human TBXA2R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC074750 Sequence: MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCR Predict reactive species\nFull Name: thromboxane A2 receptor\nCalculated Molecular Weight: 343aa,37 kDa; 1043aa,113 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC074750\nGene Symbol: TBXA2R\nGene ID (NCBI): 6915\nRRID: AB_2880782\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21731\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869386952873,"sku":"27159-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27159-1-ap","provider":"Iright","version":"1.0","type":"link"}