{"product_id":"proteintech-27160-1-ap","title":"Proteintech, 27160-1-AP, CPN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPN2 (27160-1-AP) by Proteintech is a Polyclonal antibody targeting CPN2 in WB, IHC, ELISA applications with reactivity to human samples\n27160-1-AP targets CPN2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman carboxypeptidase N (CPN), a member of the CPN\/E subfamily of \"regulatory\" metallo-carboxypeptidases, is an extracellular glycoprotein synthesized in the liver and secreted into the blood, where it controls the activity of vasoactive peptide hormones, growth factors and cytokines by specifically removing C-terminal basic residues. Normally, CPN circulates in blood plasma as a hetero-tetramer consisting of two 83 kDa (CPN2) domains each flanked by a 48 to 55 kDa catalytic (CPN1) domain (PMID:17157876). CPN2 also performs a crucial biological function in the invasion and migration of breast cancer and can be used as a biomarker for effective diagnosis and treatment of breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25801 Product name: Recombinant human CPN2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-180 aa of BC031569 Sequence: MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNL Predict reactive species\nFull Name: carboxypeptidase N, polypeptide 2\nCalculated Molecular Weight: 545 aa, 61 kDa\nObserved Molecular Weight: 83-90 kDa\nGenBank Accession Number: BC031569\nGene Symbol: CPN2\nGene ID (NCBI): 1370\nRRID: AB_3085929\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22792\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886838567081,"sku":"27160-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27160-1-ap","provider":"Iright","version":"1.0","type":"link"}