{"product_id":"proteintech-27163-1-ap","title":"Proteintech, 27163-1-AP, IL-23R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-23R (27163-1-AP) by Proteintech is a Polyclonal antibody targeting IL-23R in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27163-1-AP targets IL-23R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A431 cells,  RAW 264.7 cells,  Raji cells,  THP-1 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-23 receptor (IL-23R) is a type I cytokine receptor that plays a critical role in immune responses and inflammation. It forms a receptor complex with IL-12Rβ1 and is activated by the cytokine IL-23, which is primarily produced by dendritic cells and activated macrophages (PMID: 39796684). The genetic and epigenetic interactions in the IL-23R\/IL-17 axis are associated with elevated expression of IL-17 and inflammatory bowel disease (IBD) pathogenesis (PMID: 21672939).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25939 Product name: Recombinant human IL-23R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-130 aa of NM_144701 Sequence: MSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDE Predict reactive species\nFull Name: interleukin 23 receptor\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 65-75 kDa\nGenBank Accession Number: NM_144701\nGene Symbol: IL-23R\nGene ID (NCBI): 149233\nRRID: AB_2880783\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VWK5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869412642985,"sku":"27163-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27163-1-ap","provider":"Iright","version":"1.0","type":"link"}