{"product_id":"proteintech-27167-1-ap","title":"Proteintech, 27167-1-AP, MRP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRP4 (27167-1-AP) by Proteintech is a Polyclonal antibody targeting MRP4 in WB, ELISA applications with reactivity to human samples\n27167-1-AP targets MRP4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRP4 (also known as ABCC4), belonging to ATP-binding cassette (ABC) transporter family, is a multi-transmembrane protein that is able to transport a range of organic anionic compounds (both endogenous and xenobiotic) out of the cell. It can exclude various drugs thus is considered as potential target to prevent drug-resistance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25937 Product name: Recombinant human ABCC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 567-709 aa of BC041560 Sequence: AEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGA Predict reactive species\nFull Name: ATP-binding cassette, sub-family C (CFTR\/MRP), member 4\nCalculated Molecular Weight: 859 aa, 97 kDa\nObserved Molecular Weight: 150-180 kDa\nGenBank Accession Number: BC041560\nGene Symbol: MRP4\nGene ID (NCBI): 10257\nRRID: AB_3085931\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887724253353,"sku":"27167-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27167-1-ap","provider":"Iright","version":"1.0","type":"link"}