{"product_id":"proteintech-27174-1-ap","title":"Proteintech, 27174-1-AP, TMIGD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMIGD1 (27174-1-AP) by Proteintech is a Polyclonal antibody targeting TMIGD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n27174-1-AP targets TMIGD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, Daudi cells,  HUVEC cells,  Raji cells\nPositive IHC detected in: mouse kidney tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat small intestine tissue, mouse small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMIGD1 (Transmembrane and immunoglobulin domain containing 1) is involved in various cellular processes such as regulation of cell structure, cell-cell adhesion, and cellular movement. It protects cells from oxidative- and nutrient-deprivation-induced cell injury by stabilizing the transepithelial electric resistance and permeability of renal epithelial cells. TMIGD1 has a calculated molecular mass of 29 kDa, and can be detected as 45 kDa due to the N-glycosylation (PMID: 26342724).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25691 Product name: Recombinant human TMIGD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-207 aa of BC137201 Sequence: VEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLD Predict reactive species\nFull Name: transmembrane and immunoglobulin domain containing 1\nCalculated Molecular Weight: 262 aa, 29 kDa\nObserved Molecular Weight: 45 kDa, 29 kDa\nGenBank Accession Number: BC137201\nGene Symbol: TMIGD1\nGene ID (NCBI): 388364\nRRID: AB_2880786\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXZ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869617836201,"sku":"27174-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27174-1-ap","provider":"Iright","version":"1.0","type":"link"}