{"product_id":"proteintech-27175-1-ap","title":"Proteintech, 27175-1-AP, Complement C2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Complement C2 (27175-1-AP) by Proteintech is a Polyclonal antibody targeting Complement C2 in WB, IHC, ELISA applications with reactivity to human samples\n27175-1-AP targets Complement C2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells,  HepG2 cells,  Raji cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement C2 (C2) is a key component of the classical and lectin pathways of the complement system. Complement C2 deficiency is associated with an increased susceptibility to infections, particularly those caused by encapsulated bacteria.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25690 Product name: Recombinant human C2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 587-726 aa of BC043484 Sequence: EANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVPPPR Predict reactive species\nFull Name: complement component 2\nObserved Molecular Weight: 70 kDa, 80 kDa\nGenBank Accession Number: BC043484\nGene Symbol: C2\nGene ID (NCBI): 717\nRRID: AB_2880787\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06681\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869526315177,"sku":"27175-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27175-1-ap","provider":"Iright","version":"1.0","type":"link"}