{"product_id":"proteintech-27195-1-ap","title":"Proteintech, 27195-1-AP, EHF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EHF (27195-1-AP) by Proteintech is a Polyclonal antibody targeting EHF in WB, IHC, ELISA applications with reactivity to human samples\n27195-1-AP targets EHF in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, A431 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nETS homologous factor (EHF) is also named Epithelium-specific Ets transcription factor 3 (ESE-3), ESE3B and ESEJ. EHF is a member of the E26 transformation-specific (ETS) gene superfamily (PMID: 12894586). EHF as a tumour suppressor in PDAC. In PDAC, EHF promotes E-cadherin expression and suppresses epithelial-mesenchymal transition (PMID: 27923832). EHF deficiency induces the conversion and expansion of Treg cells and MDSCs by inhibiting TGFβ1 and GM-CSF secretion (PMID: 30733283). In prostate cancer, EHF plays a vital role in the inhibition of cell-intrinsic CSCs signal by suppressing STAT3 and repressing the expression of TWIST1, ZEB2, BMI1 and POU5F1 (PMID: 27732936, PMID: 22505649). EHF not only plays a cell autonomous role in regulating CSC stemness but also has important functions in regulating the sensitivity to a pro-CSC stimulus from the PSC niche (PMID: 33674341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25885 Product name: Recombinant human EHF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC038995 Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHT Predict reactive species\nFull Name: ets homologous factor\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC038995\nGene Symbol: EHF\nGene ID (NCBI): 26298\nRRID: AB_2880796\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZC4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868979876009,"sku":"27195-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27195-1-ap","provider":"Iright","version":"1.0","type":"link"}