{"product_id":"proteintech-27205-1-ap","title":"Proteintech, 27205-1-AP, SUMO tag Polyclonal antibody","description":"Size: 150ul\nThe SUMO tag (27205-1-AP) by Proteintech is a Polyclonal antibody targeting SUMO tag in WB, ELISA applications with reactivity to recombinant protein samples\n27205-1-AP targets SUMO tag in WB, ELISA applications and shows reactivity with recombinant protein samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe SUMO tag (Small Ubiquitin-like Modifier) is a small protein approximately 100 amino acids in length (about 11 kDa). It is a member of the ubiquitin-like protein family and shares structural similarity with ubiquitin but has distinct functions. In the field of recombinant protein expression, the SUMO tag has been developed into a useful tool for enhancing protein solubility and expression levels. The SUMO tag is a highly efficient fusion tag with numerous advantages. It plays a significant role in recombinant protein expression, purification, and functional studies. Its applications continue to expand, contributing to advancements in life science research and biotechnology development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: recombinant protein\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26104 Product name: Recombinant SUMO tag protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of Sequence: msdsevnqeakpevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedldmedndiieahreqiggs Predict reactive species\nFull Name: SUMO tag\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819477161,"sku":"27205-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27205-1-ap","provider":"Iright","version":"1.0","type":"link"}